PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG013821t1
Common NameTCM_013821
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family HD-ZIP
Protein Properties Length: 333aa    MW: 37614.4 Da    PI: 4.4651
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG013821t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.61e-1894147356
                       --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       k+++++ +q++ Le+ Fe ++++  e++ +LAk lgL+ rq+ +WFqNrRa++k
  Thecc1EG013821t1  94 KKRRLSVDQVQFLEKSFEVENKLEPERKVQLAKDLGLQPRQIAIWFQNRRARWK 147
                       566899***********************************************9 PP

2HD-ZIP_I/II127.84.5e-4193184192
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                       ekkrrls +qv++LE+sFe e+kLeperKv+la++Lglqprq+a+WFqnrRAR+ktkqlEkdyeaL+++y++lk++ ++L ke+++L+ee+ 
  Thecc1EG013821t1  93 EKKRRLSVDQVQFLEKSFEVENKLEPERKVQLAKDLGLQPRQIAIWFQNRRARWKTKQLEKDYEALQASYNSLKADYDNLLKEKDKLKEEVL 184
                       69**************************************************************************************9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.33E-1883151IPR009057Homeodomain-like
PROSITE profilePS5007117.289149IPR001356Homeobox domain
SMARTSM003896.1E-1992153IPR001356Homeobox domain
PfamPF000465.3E-1694147IPR001356Homeobox domain
CDDcd000862.04E-1794150No hitNo description
Gene3DG3DSA:1.10.10.604.3E-1996156IPR009057Homeodomain-like
PRINTSPR000311.2E-5120129IPR000047Helix-turn-helix motif
PROSITE patternPS000270124147IPR017970Homeobox, conserved site
PRINTSPR000311.2E-5129145IPR000047Helix-turn-helix motif
PfamPF021831.7E-15149190IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MAGGRVYPSN TSSAGGSNNL SVLLQSQRVP SSSEPLDPLF IPGSSPSSFL GRRSMVSFED  60
VHRANIANRS FFRTFDQEEN GDEDLDEYFH QPEKKRRLSV DQVQFLEKSF EVENKLEPER  120
KVQLAKDLGL QPRQIAIWFQ NRRARWKTKQ LEKDYEALQA SYNSLKADYD NLLKEKDKLK  180
EEVLQLTDKL LVKEKEKGNS ELSDVNKLSQ EPPQKLVVAE TASEGEESKV SVVACKQEDI  240
SSAKSDIFDS DSPHYTDGVH SSLLEAADSS YPFEPDQSDL SQDEEDNLSK GLLHPPSYIF  300
PKLEDDEYSD PPASSCNFGF PVEDHAFWSW AY*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1141149RRARWKTKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007037211.10.0Homeobox protein, putative isoform 1
TrEMBLA0A061FXY90.0A0A061FXY9_THECC; Homeobox protein, putative isoform 1
STRINGPOPTR_0015s07640.11e-174(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.17e-42homeobox 1
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]